Detailed information on CNT0002679 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs: nothing found

Most similar lncRNAs: nothing found

Expression of CNT0002679

Peptides detected in this lncRNA

>peptide 1 (30 aa)
NPKPPFLQLLAPISAFSQENGIKGIYTCLS*

Sequence

>CNT0002679
AAACCCTAAACCCCCTTTCTTGCAATTGCTGGCACCAATTTCTGCATTTTCTCAAGAGAATGGCATAAAAGGAATATATACCTGCTTGAGTTGAGAGCGA
GATAAGTTGGAGAGAGCAAAGAATTTGGTTGCATCATTTCCAGGAAATGGAGAATGAAATGAAGCGAAGTAGCAAAACCTGAGTCGGCCAAGTTGAACCA
G

lncRNA-RNA interactions

Number of interactions: 4

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA07G39450.1 Uncharacterized protein protein coding CNT0002679 163 60 CDS Trans
GLYMA07G39450.1 Uncharacterized protein protein coding CNT0002679 250 90 CDS Trans
GLYMA17G01310.1 Uncharacterized protein protein coding CNT0002679 156 59 CDS Trans
GLYMA17G01310.1 Uncharacterized protein protein coding CNT0002679 240 89 CDS Trans