RetrogeneDB ID: | retro_amel_1168 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192988.1:987186..987414(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP9 | ||
| Ensembl ID: | ENSAMEG00000014744 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 9kDa [Source:HGNC Symbol;Acc:11304] |
| Percent Identity: | 60.53 % |
| Parental protein coverage: | 88.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SRAAEKLYLADPMKARVVLKYRHSDGSLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRS |
| S.A.....L..PMKAR.V....HS.G..CIKVT..LVCLV.RTDQ....KKIEKFHSQL..L.V.K...S | |
| Retrocopy | SAAPLRNHLTSPMKARGVPQNWHSEGNSCIKVTGELVCLVQRTDQT*VLKKIEKFHSQLRPLLVTKQCCS |
| Parental | VAMETD |
| VAMETD | |
| Retrocopy | VAMETD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014744 | 2 retrocopies |
retro_amel_1168 , retro_amel_898,
|
| Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
| Homo sapiens | ENSG00000143742 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012133 | 2 retrocopies |