RetrogeneDB ID: | retro_atri_44 | ||
Retrocopy location | Organism: | Amborella (Amborella trichopoda) | |
| Coordinates: | AmTr_v1.0_scaffold00111:432876..433105(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | AMTR_s00048p00196380 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_atri_44
GAGGAGTTTAAATAATATGCACAAGAAGCCCAAACTCTGCCCCCAACCATCACTAATGCCAATAAACTCCTTCTCTATGG
CCTTTACAAGCAAACAATGTTTGCCCTGTAACACTAGCCGACCTGGGATGTTCAATCTAAGGAACATAGTGAAATGGGAT
GCTAGGAAGGCGGTTGAAGGGAGATCAAAGAACGAGGCAATGAGCAACTACATCACCAAGGTTTCTAAA
ORF - retro_atri_44 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 68.35 % |
| Parental protein coverage: | 85.56 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
Retrocopy - Parental Gene Alignment:
| Parental | EEFEEYAEKAKSLPPTTTDADKLILYGLYKQA-TVGPV-NTSRPGMFNPRDRAKWDAWKAVEGKSKDEAM |
| EEF..YA..A..LPPT.T.A.KL.LYGLYKQ...V.PV.NTSRPGMFN.R...KWDA.KAVEG.SK.EAM | |
| Retrocopy | EEFK*YAQEAQTLPPTITNANKLLLYGLYKQT<NVCPV<NTSRPGMFNLRNIVKWDARKAVEGRSKNEAM |
| Parental | SDYITKVKQ |
| S.YITKV.. | |
| Retrocopy | SNYITKVSK |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Amborella trichopoda was not studied using RNA-Seq expression data.
Amborella trichopoda was not studied using ChIP-Seq data.
Amborella trichopoda was not studied using EST data.
Amborella trichopoda was not studied using FANTOM5 data.
retro_atri_44 was not experimentally validated.
Retrocopy orthology:
Amborella trichopoda does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Amborella trichopoda | AMTR_s00048p00196380 | 1 retrocopy |
retro_atri_44 ,
|