RetrogeneDB ID: | retro_btau_946 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 21:8161198..8161528(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COPR5 | ||
| Ensembl ID: | ENSBTAG00000001885 | ||
| Aliases: | COPRS, C19H17orf79, COPR5 | ||
| Description: | Cooperator of PRMT5 [Source:UniProtKB/Swiss-Prot;Acc:A5PJD3] |
| Percent Identity: | 50.86 % |
| Parental protein coverage: | 61.62 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | PGTAFAPADHSSQEKATENATDRLA-NGAQSIPHDSPAHGEGTHCEEEG-FAEDDEDSDGEPSPWELSEG |
| PG..FA..........TE.A.D..A..GAQS...D..AHGEG....EEG..A..D.DS.GE...WELSEG | |
| Retrocopy | PGPGFAQLS-TLVRRETEKARDLRA<LGAQSTSPDGLAHGEGAR-SEEG>RALGDGDSAGEQNVWELSEG |
| Parental | MSGCLPKEQAGDLFHEDWDLELKADQGNPYDADDIQGCLSQEVRPW |
| .S...PK..A..L..ED.D..LKA...NP.DA.DIQ.CLS..VRPW | |
| Retrocopy | VSSRPPK--ASGLLSED*DPGLKAGHRNPEDAEDIQSCLSAGVRPW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 0 .65 RPM |
| ERP005899_muscle | 0 .00 RPM | 2 .43 RPM |
| SRP017611_brain | 0 .00 RPM | 14 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .05 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .98 RPM |
| SRP030211_testis | 0 .03 RPM | 48 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001885 | 1 retrocopy |
retro_btau_946 ,
|
| Callithrix jacchus | ENSCJAG00000014110 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016418 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008153 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000111 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008542 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009909 | 1 retrocopy |