RetrogeneDB ID: | retro_cfam_1491 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 32:5635694..5635943(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR4 | ||
| Ensembl ID: | ENSCAFG00000014561 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 4 [Source:HGNC Symbol;Acc:33772] |
| Percent Identity: | 95.18 % |
| Parental protein coverage: | 84.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | GYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHHSTNIPFKRLSVVFGEHTLLVTVSGQRVFV |
| GYLVLSEGAVLA.SGDLEN.EQAASAISELVSTACGFRLHHSTNIPFKRLS.VFGEHTLLVTVSGQRVFV | |
| Retrocopy | GYLVLSEGAVLA*SGDLENEEQAASAISELVSTACGFRLHHSTNIPFKRLSLVFGEHTLLVTVSGQRVFV |
| Parental | VKRQNRGREPVDV |
| VKRQN.GREPVDV | |
| Retrocopy | VKRQN*GREPVDV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .13 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014561 | 1 retrocopy |
retro_cfam_1491 ,
|
| Cavia porcellus | ENSCPOG00000013370 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050552 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003476 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011987 | 1 retrocopy |