RetrogeneDB ID: | retro_cfam_721 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 16:8131630..8131810(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MED10 | ||
| Ensembl ID: | ENSCAFG00000010346 | ||
| Aliases: | None | ||
| Description: | mediator complex subunit 10 [Source:HGNC Symbol;Acc:28760] |
| Percent Identity: | 63.33 % |
| Parental protein coverage: | 57.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | CRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQEL |
| CRQQLH.IT.P.EVF.YIDQ..N.Q.....CLE..LAKNE..KGK.DT...FK.LL.QEL | |
| Retrocopy | CRQQLHNITPPSEVFQYIDQD*NSQPDMETCLEMSLAKNE*AKGKMDTIRTFKTLLFQEL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 4 .96 RPM |
| SRP017611_brain | 0 .00 RPM | 5 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .34 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Equus caballus | retro_ecab_796 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006767 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000010346 | 1 retrocopy |
retro_cfam_721 ,
|
| Dasypus novemcinctus | ENSDNOG00000004579 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023738 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000027 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000002025 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005988 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015506 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014579 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002763 | 1 retrocopy |