RetrogeneDB ID: | retro_chof_138 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_313:43606..43849(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C3orf14 | ||
| Ensembl ID: | ENSCHOG00000004965 | ||
| Aliases: | None | ||
| Description: | chromosome 3 open reading frame 14 [Source:HGNC Symbol;Acc:25024] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 63.49 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KASQMQAAKTAYKRNVSLLKDIEAAAKSLQTRIHPLSQPEVVSLETHY-ASVEYIPKWEQFLLGKAPYPI |
| K..QMQAA.TAYKRN..LL.DI..A..SLQTRIHPL.QPE.VSLETHY..S..YIPKWEQFLLGKAPYPI | |
| Retrocopy | KRHQMQAAETAYKRNLGLLNDI*VAEMSLQTRIHPLPQPEGVSLETHYWESIKYIPKWEQFLLGKAPYPI |
| Parental | GFENQNKVENA |
| GFENQN..ENA | |
| Retrocopy | GFENQNEAENA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015374 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000007123 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004965 | 7 retrocopies |
retro_chof_138 , retro_chof_2082, retro_chof_423, retro_chof_536, retro_chof_659, retro_chof_73, retro_chof_96,
|
| Erinaceus europaeus | ENSEEUG00000000474 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027983 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000013085 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000016406 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016914 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000033111 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008107 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000017312 | 1 retrocopy |