RetrogeneDB ID: | retro_chof_783 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_147798:38..276(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPC5 | ||
| Ensembl ID: | ENSCHOG00000000560 | ||
| Aliases: | None | ||
| Description: | actin related protein 2/3 complex, subunit 5, 16kDa [Source:HGNC Symbol;Acc:708] |
| Percent Identity: | 51.81 % |
| Parental protein coverage: | 53.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GGDGQA-GPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAV |
| GG..QA.GPD...V...L.....G.M....QA.L.N.PINTK.QAVK..A....LKVL...K...IE.AV | |
| Retrocopy | GGYDQA>GPDQSKVNKLLWQ---GDMFPVFQADLQNSPINTKKQAVKE*AQIVILKVLTNVKSSEIEQAV |
| Parental | QSLDKNSVDLLMK |
| .SLD.N..DLLMK | |
| Retrocopy | HSLDRNGIDLLMK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000560 | 2 retrocopies |
retro_chof_1502, retro_chof_783 ,
|
| Dasypus novemcinctus | ENSDNOG00000010375 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000014969 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007194 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000008475 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028062 | 1 retrocopy |