RetrogeneDB ID: | retro_chof_92 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_1787:37439..37688(-) | ||
| Located in intron of: | ENSCHOG00000003460 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNCA | ||
| Ensembl ID: | ENSCHOG00000007186 | ||
| Aliases: | None | ||
| Description: | synuclein, alpha (non A4 component of amyloid precursor) [Source:HGNC Symbol;Acc:11138] |
| Percent Identity: | 80.72 % |
| Parental protein coverage: | 66.94 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGGPQEGILQDMPVDPDNEAYEM |
| .TKEQVTN.GEAVVTGVTAVA.KTVEGAGSIAAATGFGKKDQLGK...G.PQEGIL.D.PVDPDN.AYE. | |
| Retrocopy | ETKEQVTNAGEAVVTGVTAVAKKTVEGAGSIAAATGFGKKDQLGKSKGGRPQEGILEDKPVDPDNDAYEI |
| Parental | PSEEGIPDYEPKA |
| .SEEG...YEP.A | |
| Retrocopy | HSEEGYQGYEPEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007186 | 1 retrocopy |
retro_chof_92 ,
|
| Felis catus | ENSFCAG00000011488 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005634 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023825 | 1 retrocopy |