RetrogeneDB ID: | retro_cint_35 | ||
Retrocopylocation | Organism: | Vase tunicate (Ciona intestinalis) | |
Coordinates: | HT001064.1:1063..1282(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCING00000023163 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52. % |
Parental protein coverage: | 52.08 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KIQLRLSNQRLNDDDVKYLAGCLGNISLFDMWETYISSDQCRVLKQAIQQLPSSRISIWKMQPVILWSGL |
.IQL.L..Q.L...DV.YLAGCLGNIS...M..T.I....C.VLKQAIQQLPS..I......P.IL.... | |
Retrocopy | QIQLELVQQKLCGRDVIYLAGCLGNISRLEMSHTVILKEHCSVLKQAIQQLPS--IQVHQLYPDILSTYP |
Parental | NNTKD |
N.T.. | |
Retrocopy | NVTRN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ciona intestinalis | ENSCING00000023163 | 2 retrocopies |
retro_cint_32, retro_cint_35 ,
|