RetrogeneDB ID: | retro_cint_35 | ||
Retrocopy location | Organism: | Vase tunicate (Ciona intestinalis) | |
| Coordinates: | HT001064.1:1063..1282(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCING00000023163 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_cint_35
CAGATTCAACTTGAATTGGTGCAACAAAAATTGTGTGGTCGTGACGTCATATACTTAGCTGGTTGTCTTGGCAATATATC
TCGGTTGGAAATGTCGCACACCGTTATTTTAAAAGAACATTGCAGTGTCCTGAAACAAGCGATACAACAACTTCCATCCA
TCCAGGTTCATCAACTTTATCCAGATATTTTATCAACTTATCCCAATGTTACACGAAAC
ORF - retro_cint_35 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 52.0 % |
| Parental protein coverage: | 52.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | KIQLRLSNQRLNDDDVKYLAGCLGNISLFDMWETYISSDQCRVLKQAIQQLPSSRISIWKMQPVILWSGL |
| .IQL.L..Q.L...DV.YLAGCLGNIS...M..T.I....C.VLKQAIQQLPS..I......P.IL.... | |
| Retrocopy | QIQLELVQQKLCGRDVIYLAGCLGNISRLEMSHTVILKEHCSVLKQAIQQLPS--IQVHQLYPDILSTYP |
| Parental | NNTKD |
| N.T.. | |
| Retrocopy | NVTRN |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Ciona intestinalis was not studied using RNA-Seq expression data.
Ciona intestinalis was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cint_35 retrocopy.
Ciona intestinalis was not studied using FANTOM5 data.
retro_cint_35 was not experimentally validated.
Retrocopy orthology:
Ciona intestinalis does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000023163 | 2 retrocopies |
retro_cint_32, retro_cint_35 ,
|