>retro_cjac_2832
ACCCACACACTCTCTCACACTCATACACGCCCTCATACATGCACATTCAGACACACACACACTCATACACACACCCAGAA
ACACAGAGTCATATACACATTGTACACACACACACACACACACACCCATACACACATTTCTACACACAAACAC
ORF - retro_cjac_2832 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: |
53.85 % |
Parental protein coverage: |
78.79 % |
Number of stop codons detected: |
0 |
Number of frameshifts detected |
0 |
Retrocopy - Parental Gene Alignment:
Parental | THTHTHTHTYFTYRFTHTHTHTHTHAHTHEMVTPTHTHTHTHTHTRLCTHAH |
| THT..HTHT......T..HTHTHTH...H.......THTHTHTHT...TH.H |
Retrocopy | THTLSHTHTR-PHTCTFRHTHTHTHTQKHRVIYTLYTHTHTHTHTHISTHKH |
|
Legend:
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
Library |
Retrocopy expression |
Parental gene expression |
SRP051959_colon |
0 .00 RPM |
0 .02 RPM |
SRP051959_heart |
0 .00 RPM |
0 .23 RPM |
SRP051959_kidney |
0 .00 RPM |
0 .09 RPM |
SRP051959_liver |
0 .00 RPM |
0 .02 RPM |
SRP051959_lung |
0 .00 RPM |
0 .44 RPM |
SRP051959_lymph_node |
0 .00 RPM |
0 .00 RPM |
SRP051959_skeletal_muscle |
0 .00 RPM |
0 .02 RPM |
SRP051959_spleen |
0 .00 RPM |
0 .17 RPM |
Callithrix jacchus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cjac_2832 retrocopy.
Callithrix jacchus was not studied using FANTOM5 data.
retro_cjac_2832 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_cjac_2832 has 0 orthologous retrocopies within eutheria group .
Parental genes homology:
Parental genes homology involve
1 parental gene, and
4 retrocopies.