RetrogeneDB ID: | retro_cjac_3874 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | GL285606.1:1628..1893(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RARRES2 | ||
Ensembl ID: | ENSCJAG00000010322 | ||
Aliases: | None | ||
Description: | retinoic acid receptor responder (tazarotene induced) 2 [Source:HGNC Symbol;Acc:9868] |
Percent Identity: | 56.04 % |
Parental protein coverage: | 54.66 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | QQTDCRKEDWKKPHCKVKPNGRKRKCLACIKLGSENEVLGRMIHCPT-KTQVLREPKEYQENQCIKVQRA |
..T..R...WKKP.CKV.PNGRK.KCL.C.KLGSE..VL.RM.HCPT.KTQ..REP...QE..C.....A | |
Retrocopy | RHTSGRRKGWKKPKCKVQPNGRKQKCLTCVKLGSEDKVLDRMVHCPT<KTQTWREPE*RQETWCSAAELA |
Parental | -GEDPNSLGFPG-LLFSKALP |
..E.P.S...P...LFSK.LP | |
Retrocopy | <DEEPCSHCLPAQFLFSKVLP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .26 RPM |
SRP051959_heart | 0 .00 RPM | 3 .46 RPM |
SRP051959_kidney | 0 .00 RPM | 2 .06 RPM |
SRP051959_liver | 0 .00 RPM | 17 .55 RPM |
SRP051959_lung | 0 .00 RPM | 3 .89 RPM |
SRP051959_lymph_node | 0 .00 RPM | 2 .44 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 0 .81 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .58 RPM |