RetrogeneDB ID: | retro_cpor_1169 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_52:10224889..10225132(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LYRM2 | ||
| Ensembl ID: | ENSCPOG00000015625 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.01 % |
| Parental protein coverage: | 92.05 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAASRLPPGTLTLKQFLRRQQVLLLYRRILQAIRQVPNACDRKYLQNWAREEFKRNKSATEEDTIQMMIT |
| MA.S.....TL.LKQFLRRQQ.LLL.RRILQAI.Q.PN.CD.KYL.NWAREEFKRNKSATEEDTIQM.IT | |
| Retrocopy | MAISHVLGATLSLKQFLRRQQILLLCRRILQAIWQAPNVCDHKYLKNWAREEFKRNKSATEEDTIQMTIT |
| Parental | QGNIQLKELEK |
| QGNIQLKE..K | |
| Retrocopy | QGNIQLKEF*K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .91 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .96 RPM |
| SRP040447_lung | 0 .00 RPM | 3 .76 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 9 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000000905 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015625 | 4 retrocopies | |
| Homo sapiens | ENSG00000083099 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000009916 | 1 retrocopy |