RetrogeneDB ID: | retro_dnov_1040 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_140123:1063..1465(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GEMIN2 | ||
| Ensembl ID: | ENSDNOG00000018278 | ||
| Aliases: | None | ||
| Description: | gem (nuclear organelle) associated protein 2 [Source:HGNC Symbol;Acc:10884] |
| Percent Identity: | 74.64 % |
| Parental protein coverage: | 63.98 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 3 |
| Parental | KRRQTVNVSLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQSMNKHRSHWKSQQLDSNVTMPKSEDEEGWK- |
| K.RQTVNVSL.GCQPAP.GYS..LQ.QQQQVA.FSTV.QS.NKHR...K.QQLDSN.TMPKSE.EEGWK. | |
| Retrocopy | K*RQTVNVSL*GCQPAPKGYSLILQKQQQQVARFSTV*QSVNKHRRPQKPQQLDSNMTMPKSEHEEGWK< |
| Parental | KFCLGERLCAEGAPGPATNENPGIDYVQI-GFPPLLSI-VSRMNQATVTSVLEYLSNWFGERDFTPEL |
| .FCLGERLCA.G..GPAT.ENP.ID.V....F.PLL....SR.NQA.VTS.LEYLSNWFGERDFTPEL | |
| Retrocopy | NFCLGERLCAGGTAGPATSENPEIDCV*V<DFLPLLRL<ISRKNQAIVTSILEYLSNWFGERDFTPEL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 7 .39 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 19 .93 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .89 RPM |
| SRP012922_kidney | 0 .00 RPM | 5 .48 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .49 RPM |
| SRP012922_lung | 0 .15 RPM | 9 .01 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .37 RPM |
| SRP012922_spleen | 0 .00 RPM | 12 .82 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016248 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018278 | 1 retrocopy |
retro_dnov_1040 ,
|
| Homo sapiens | ENSG00000092208 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016691 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000004811 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002619 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000060121 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005764 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006291 | 1 retrocopy |