RetrogeneDB ID: | retro_dnov_1181 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_15905:44099..44529(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | VTCN1 | ||
| Ensembl ID: | ENSDNOG00000013317 | ||
| Aliases: | None | ||
| Description: | V-set domain containing T cell activation inhibitor 1 [Source:HGNC Symbol;Acc:28873] |
| Percent Identity: | 64.19 % |
| Parental protein coverage: | 53.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | LTDAGTYKCYIITSKGKGNANLEYKTGAFSV-PEVNVNYNASSESLRCEAPRWF-PQPTVVWASQADQGA |
| .TDAGTYK.YII.SKGKGNANLEYK.G.F...P.VNV.YNA.SE.L...AP.WF.P..TV.WASQ.D.G. | |
| Retrocopy | VTDAGTYKHYIIISKGKGNANLEYKIGPFCI<PKVNVDYNAHSEILQYNAPQWF>PPSTVIWASQVDEGT |
| Parental | NFSEVST-SFELNSENVTMKVVSVLYNVT-INNTYSCMIENSIAKATGDIKVTDSEIKRQSHLQLLNSKA |
| NFSEVS...FELNSENV..KVV...Y.VT.INNTYSCM.EN....ATGDIK.TDS..K..S..QLLNSK. | |
| Retrocopy | NFSEVSNIGFELNSENVIRKVVFMFYTVT>INNTYSCMTENNTVRATGDIKGTDSGQKMES--QLLNSKV |
| Parental | SLGVSSFC |
| .......C | |
| Retrocopy | LVYLFFLC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 1 .36 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .55 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .46 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005097 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013317 | 1 retrocopy |
retro_dnov_1181 ,
|
| Homo sapiens | ENSG00000134258 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025814 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016964 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005256 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001164 | 1 retrocopy |