RetrogeneDB ID: | retro_dnov_1276 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_17441:15054..15476(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000000282 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PAFAH1B3 | ||
| Ensembl ID: | ENSDNOG00000002870 | ||
| Aliases: | None | ||
| Description: | platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [Source:HGNC Symbol;Acc:8576] |
| Percent Identity: | 63.38 % |
| Parental protein coverage: | 61.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QHVLWRLENGDHEHIRPKIVVVWVGTNNHGHTAEQVTGGIEAIVQLVNQRQPQARVVVLGLLPRGQHPNP |
| .HVLWRL.NG..E.I.PK..VVWVGTNNH..TAE.V.GGIEAIVQL.N.RQPQA..VVLGLLPRG..PNP | |
| Retrocopy | RHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIVVLGLLPRGEKPNP |
| Parental | LREKNQQVNKLVRVAL-AGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL |
| LR.KN..VN.L..V.L.AG......LD.D.GFVHSDG.IS.HDM.D.LHL...GY...C..LH.L...LL | |
| Retrocopy | LRQKNAKVNQLLKVSL<AGAANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLL |
| Parental | AQ |
| .. | |
| Retrocopy | EE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 26 .45 RPM | 34 .81 RPM |
| SRP012922_cerebellum | 43 .03 RPM | 38 .63 RPM |
| SRP012922_heart | 6 .73 RPM | 4 .18 RPM |
| SRP012922_kidney | 8 .21 RPM | 32 .31 RPM |
| SRP012922_liver | 7 .28 RPM | 6 .50 RPM |
| SRP012922_lung | 23 .83 RPM | 37 .11 RPM |
| SRP012922_quadricep_muscle | 3 .81 RPM | 5 .54 RPM |
| SRP012922_spleen | 20 .83 RPM | 27 .24 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019787 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004847 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002870 | 1 retrocopy |
retro_dnov_1276 ,
|
| Macaca mulatta | ENSMMUG00000012172 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007574 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020481 | 1 retrocopy |