RetrogeneDB ID: | retro_dnov_153 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2147:225009..225264(-) | ||
Located in intron of: | ENSDNOG00000003645 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS24 | ||
Ensembl ID: | ENSDNOG00000016853 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein S24 [Source:HGNC Symbol;Acc:14510] |
Percent Identity: | 63.53 % |
Parental protein coverage: | 50.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MASLACGRGIAARVLAGSRGPLCAGRALHVSAACAKNRAARIRVGKGDKPVTYEEAHAPHYIAHRKGWLS |
MA...C....AA.VLA.S...LC.G.AL.VSAAC.KNRAAR...GK.DKP.TY..AH.P.YI.HRKGWL. | |
Retrocopy | MAAFGCSQVLAAHVLARSQELLCTGHALQVSAACPKNRAARVHLGKEDKPMTYKKAHMPYYITHRKGWLL |
Parental | LHTGNLDGEEHAAER |
L.TGNLDG.EHA.E. | |
Retrocopy | LCTGNLDGREHAVEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 17 .31 RPM |
SRP012922_cerebellum | 0 .00 RPM | 13 .33 RPM |
SRP012922_heart | 0 .00 RPM | 12 .53 RPM |
SRP012922_kidney | 0 .00 RPM | 16 .98 RPM |
SRP012922_liver | 0 .00 RPM | 14 .86 RPM |
SRP012922_lung | 0 .00 RPM | 16 .49 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 20 .25 RPM |
SRP012922_spleen | 0 .00 RPM | 16 .94 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017491 | 1 retrocopy | |
Bos taurus | ENSBTAG00000007398 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003106 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000016853 | 3 retrocopies |
retro_dnov_1195, retro_dnov_153 , retro_dnov_2049,
|
Echinops telfairi | ENSETEG00000016782 | 1 retrocopy | |
Homo sapiens | ENSG00000062582 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005692 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000011905 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002405 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000013889 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019127 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000015911 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000002938 | 1 retrocopy |