RetrogeneDB ID: | retro_dnov_2281 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_606:133661..134045(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB6 | ||
| Ensembl ID: | ENSDNOG00000019864 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa [Source:HGNC Symbol;Acc:7701] |
| Percent Identity: | 72.87 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRKVWPLEEFWNKFLQNKSPWRKTLYKVYGHSVF |
| MSG..P.EKLRLQQL.ELRRRWLK..ELSP.EPVLPPRKVWP.EEFWNKFLQNK.P.R..LYKV.GHSVF | |
| Retrocopy | MSGCVPVEKLRLQQLQELRRRWLKE-ELSPGEPVLPPRKVWPVEEFWNKFLQNKFPRRSILYKV*GHSVF |
| Parental | AFTHVL-IPAWIIHYYLKYHVNXXXXXXXXXXXXXXXGDIILETGEVVPPMKEFPDQHH |
| .F.HVL.IPAWI.HYY.KYHVN...............GDIILETGEVV.PMK.FPDQHH | |
| Retrocopy | SFAHVLIIPAWIVHYYVKYHVNTEPYAIVERKPRIFPGDIILETGEVVLPMKQFPDQHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 3 .11 RPM | 152 .07 RPM |
| SRP012922_cerebellum | 2 .47 RPM | 71 .07 RPM |
| SRP012922_heart | 3 .71 RPM | 231 .80 RPM |
| SRP012922_kidney | 3 .56 RPM | 146 .21 RPM |
| SRP012922_liver | 2 .01 RPM | 57 .12 RPM |
| SRP012922_lung | 0 .46 RPM | 45 .97 RPM |
| SRP012922_quadricep_muscle | 2 .42 RPM | 188 .84 RPM |
| SRP012922_spleen | 0 .69 RPM | 51 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000001263 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007852 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019864 | 2 retrocopies |
retro_dnov_2281 , retro_dnov_920,
|
| Ochotona princeps | ENSOPRG00000007428 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000011003 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013268 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002785 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012172 | 1 retrocopy |