RetrogeneDB ID: | retro_dnov_47 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_43468:18874..19144(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000025265 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000016021 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 94.03 % |
Parental protein coverage: | 74.44 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH |
SI..LKEK.KKRKGRGFGSEEGSRA.MREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH | |
Retrocopy | SIQELKEKVKKRKGRGFGSEEGSRAHMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .39 RPM | 27 .03 RPM |
SRP012922_cerebellum | 0 .41 RPM | 15 .12 RPM |
SRP012922_heart | 0 .23 RPM | 6 .50 RPM |
SRP012922_kidney | 0 .55 RPM | 16 .43 RPM |
SRP012922_liver | 0 .31 RPM | 10 .06 RPM |
SRP012922_lung | 0 .46 RPM | 18 .17 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 4 .67 RPM |
SRP012922_spleen | 0 .34 RPM | 17 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000016021 | 1 retrocopy |
retro_dnov_47 ,
|
Echinops telfairi | ENSETEG00000008411 | 1 retrocopy | |
Felis catus | ENSFCAG00000026379 | 1 retrocopy | |
Homo sapiens | ENSG00000131795 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016058 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000017436 | 2 retrocopies | |
Mus musculus | ENSMUSG00000038374 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000000202 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000013316 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000021215 | 2 retrocopies | |
Sorex araneus | ENSSARG00000013289 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000014947 | 2 retrocopies |