RetrogeneDB ID: | retro_ecab_851 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 5:15127853..15128078(-) | ||
| Located in intron of: | ENSECAG00000021962 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000021149 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_ecab_851
AAGGAGAAAACAAAGAAACACATCATAAAAAAGAAACTACATAATTCAATGGGTAGACCAGAACACACAGGATGAGAAAC
AAATGAAATGCAGGAGAGCCAGAAAACAAGTGATAAAATAGCAGCACTAAGCCCACATATATCCATAATCACACTAAATG
TAAATAGATTGAATTCTCCAATAAAAAGACACAGAGTGGCAAGATGGATTAAAGAACAAGACCCG
ORF - retro_ecab_851 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 62.67 % |
| Parental protein coverage: | 61.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | QEILKKALIPEKKKRWNKIPKYTRQETKELQENQKMSDKMATLSPHISIITLNVNGLNSSIKIHRVATWI |
| .E..KK..I..K.......P..T..ET.E.QE.QK.SDK.A.LSPHISIITLNVN.LNS.IK.HRVA.WI | |
| Retrocopy | KEKTKKHIIKKKLHNSMGRPEHTG*ETNEMQESQKTSDKIAALSPHISIITLNVNRLNSPIKRHRVARWI |
| Parental | KEQDP |
| KEQDP | |
| Retrocopy | KEQDP |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 0 .00 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP021940_embryo | 0 .00 RPM | 0 .00 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 0 .00 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 0 .00 RPM |
| SRP021940_testis | 0 .00 RPM | 0 .00 RPM |
Equus caballus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ecab_851 retrocopy.
Equus caballus was not studied using FANTOM5 data.
retro_ecab_851 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ecab_851 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000021149 | 1 retrocopy |
retro_ecab_851 ,
|