RetrogeneDB ID: | retro_etel_122 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_2286:33869..34231(-) | ||
| Located in intron of: | ENSETEG00000013387 | ||
Retrocopy information | Ensembl ID: | ENSETEG00000013389 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB4A | ||
| Ensembl ID: | ENSETEG00000018042 | ||
| Aliases: | None | ||
| Description: | RAB4A, member RAS oncogene family [Source:HGNC Symbol;Acc:9781] |
| Percent Identity: | 78.86 % |
| Parental protein coverage: | 55.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | RETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENGNLMFLETSALTGENVEEA |
| .ETYN.L.NWLTDARMLASQ..VIILCGN.KDLDADREVTFLEASRF.QE...LM..E.SAL.GEN.EE. | |
| Retrocopy | QETYNELSNWLTDARMLASQDTVIILCGNTKDLDADREVTFLEASRFTQED-ELMLPERSALPGENGEET |
| Parental | -FVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAQSAQECGC |
| ..VQCARKILNKI.SG.LDPERMG.GIQ.GD.ALRQL..PR.AQAQSAQECGC | |
| Retrocopy | <LVQCARKILNKIDSGGLDPERMGPGIQGGDTALRQLEAPRGAQAQSAQECGC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013866 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000004920 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000010340 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018042 | 3 retrocopies |
retro_etel_1163, retro_etel_122 , retro_etel_681,
|
| Macaca mulatta | ENSMMUG00000017720 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014339 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000128 | 1 retrocopy |