RetrogeneDB ID: | retro_etel_491 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_8216:200644..200873(+) | ||
Located in intron of: | ENSETEG00000008048 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NAA38 | ||
Ensembl ID: | ENSETEG00000011594 | ||
Aliases: | None | ||
Description: | N(alpha)-acetyltransferase 38, NatC auxiliary subunit [Source:HGNC Symbol;Acc:20471] |
Percent Identity: | 59.26 % |
Parental protein coverage: | 83.33 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VAVITSDGRMIVGTLKGFDQTINLILDESHERVFSS-SQGVEQVVLGLYIVRGDNVAVIGEIDEETDSAL |
...I.SD.R..VGTL....QT..LILDES.ERV....S.GV.QVV.....VRG.N.A..GEIDEETDS.L | |
Retrocopy | LSLINSDRRTDVGTLESCNQTMSLILDESQERVIAL>SRGVGQVVM----VRGANAAGTGEIDEETDSVL |
Parental | DLGNIRAEPLN |
DLG.I.AEP.N | |
Retrocopy | DLGSI*AEP*N |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001162 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000011594 | 1 retrocopy |
retro_etel_491 ,
|
Felis catus | ENSFCAG00000023642 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000006837 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015822 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007100 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017359 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000013377 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000014809 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000018435 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000009039 | 3 retrocopies |