RetrogeneDB ID: | retro_ggor_1847 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:48731994..48732326(+) | ||
| Located in intron of: | ENSGGOG00000011003 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000183336 | ||
| Ensembl ID: | ENSGGOG00000012724 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.54 % |
| Parental protein coverage: | 73.03 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | QQGSVAGVRAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVVSAKFE |
| .Q...AGV.AGV.SLLGC..SWTAA.ELS...L.EKLQ.D.EA.H.EVED.TLNRCAC.FRVLVVSAKFE | |
| Retrocopy | KQRGQAGV*AGVLSLLGCGPSWTAATELSTK*LQEKLQWDPEAKHMEVEDVTLNRCACNFRVLVVSAKFE |
| Parental | GKPLLQRHRLVNACLAE-ELPHIHAFEQKTLTPDQWARERQK |
| GK.LLQ.H..VN..LA...L.HIHAFEQKTL.P.QWA.E.QK | |
| Retrocopy | GKLLLQTHWRVNMWLAG<RLSHIHAFEQKTLIPEQWACEQQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 12 .56 RPM |
| SRP007412_cerebellum | 0 .39 RPM | 7 .45 RPM |
| SRP007412_heart | 0 .03 RPM | 9 .26 RPM |
| SRP007412_kidney | 0 .12 RPM | 10 .34 RPM |
| SRP007412_liver | 0 .18 RPM | 7 .31 RPM |
| SRP007412_testis | 0 .10 RPM | 16 .37 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2644 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
| Homo sapiens | ENSG00000169627 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies |
retro_ggor_1847 , retro_ggor_75,
|
| Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |