RetrogeneDB ID: | retro_ggor_722 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 11:70810580..70810808(-) | ||
Located in intron of: | ENSGGOG00000022915 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC58 | ||
Ensembl ID: | ENSGGOG00000001964 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.89 % |
Parental protein coverage: | 52.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAAPSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRV |
MAAPSGGVN.EEFA.FQELLKV.RT.DDRIV..LNT.V.TASF.GKIDASQTCKQ.Y.SLMAA.ASR.RV | |
Retrocopy | MAAPSGGVNWEEFAQFQELLKVIRTSDDRIVYKLNTKVLTASFVGKIDASQTCKQIYGSLMAALASRNRV |
Parental | IKNCIA |
IKNCIA | |
Retrocopy | IKNCIA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .82 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .98 RPM |
SRP007412_heart | 0 .00 RPM | 0 .66 RPM |
SRP007412_kidney | 0 .00 RPM | 2 .37 RPM |
SRP007412_liver | 0 .00 RPM | 2 .72 RPM |
SRP007412_testis | 0 .00 RPM | 1 .55 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_768 |