RetrogeneDB ID: | retro_lafr_311 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_12:39407177..39407414(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC2 | ||
Ensembl ID: | ENSLAFG00000004378 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.48 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MHPDLSPHLHTEECNILINLLKECHKNHSFLKFFGHCNDLDRQMRKCLKKEYVEKRAKSRERGDAMRKRL |
M.PD.SPHLHTEECN.LINLL.E.HKNHS.LKFFGHCN..D.QMRKCLK.EYV.KR.KS...G.AMRKRL | |
Retrocopy | MYPD*SPHLHTEECNTLINLLTERHKNHSILKFFGHCNGVDHQMRKCLKNEYVKKRTKSKKHGKAMRKRL |
Parental | FNPPQESEK |
FNPP.ESEK | |
Retrocopy | FNPPEESEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013929 | 2 retrocopies | |
Bos taurus | ENSBTAG00000017009 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010422 | 3 retrocopies | |
Felis catus | ENSFCAG00000004977 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000004378 | 2 retrocopies |
retro_lafr_311 , retro_lafr_896,
|
Microcebus murinus | ENSMICG00000011915 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025763 | 1 retrocopy | |
Sorex araneus | ENSSARG00000008906 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001006 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000038 | 3 retrocopies |