RetrogeneDB ID: | retro_mdom_1446 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 5:90574789..90575225(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CENPK | ||
Ensembl ID: | ENSMODG00000019645 | ||
Aliases: | None | ||
Description: | centromere protein K [Source:HGNC Symbol;Acc:29479] |
Percent Identity: | 64.86 % |
Parental protein coverage: | 53.7 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | REQEWLNEQEHLVTSLSKKCKERKNQVIPFSEQRTFFEMNTKMTKIQSQREKLLNSLGEFLDKHFPPP-E |
.EQ.WLNEQE.LV....K.....K.....F........M.TKMT.IQ..REKLL.SLGEFLDKHFP.P.. | |
Retrocopy | QEQQWLNEQEQLVIFQ*KM*GTKKSSDTIF*AKDXXXKMKTKMTNIQRYREKLLTSLGEFLDKHFPFP>X |
Parental | ENGN-KRKRECKPTAQLKTLREILEVLINSLL-RSPYNPYVKIDDSYWPPYIELLLRNGIALRHQDDPNQ |
..GN.KRKRECKPTAQLKTL.EILEV.IN.LL..SP..PY..I.DS.WPPYIELLL..GIA.RHQDDPNQ | |
Retrocopy | XXGNKKRKRECKPTAQLKTLHEILEVHINCLLQKSPHDPY--INDSFWPPYIELLLHRGIAIRHQDDPNQ |
Parental | IRLEAFHQ |
I.LE.FHQ | |
Retrocopy | I*LEVFHQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013993 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000007357 | 1 retrocopy | |
Equus caballus | ENSECAG00000019165 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000005831 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019645 | 1 retrocopy |
retro_mdom_1446 ,
|
Oryctolagus cuniculus | ENSOCUG00000011568 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000006527 | 1 retrocopy |