RetrogeneDB ID: | retro_mdom_1641 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:15862133..15862439(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF5A | ||
| Ensembl ID: | ENSMODG00000006652 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:3300] |
| Percent Identity: | 52.83 % |
| Parental protein coverage: | 64.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | DDLDFETG-DAGASATFPMQ-CSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE |
| .DL.F..G..AG.S.TF..Q..S.L.KN....LKG.PCKIV...TSK..KH.....HLV...IF..KK.. | |
| Retrocopy | NDLNFHIG<SAGVSGTFHTQ<ASTLKKNHCRILKGQPCKIVGVFTSKSIKHDRFIIHLVHVNIFIRKKLK |
| Parental | DICPSTHNMDVPNIKRNDFQ-LIGIQDG-YLSLLQD |
| D...ST.NM.V.NIKRNDF..LI.I..G..L.LLQD | |
| Retrocopy | DTYSSTYNMVVLNIKRNDFH<LIVILNGHFLILLQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000132507 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012032 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000012459 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006206 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000006652 | 2 retrocopies |
retro_mdom_1641 , retro_mdom_190,
|
| Otolemur garnettii | ENSOGAG00000014230 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007907 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008674 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016478 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000017939 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009783 | 1 retrocopy |