RetrogeneDB ID: | retro_mdom_1641 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 6:15862133..15862439(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF5A | ||
Ensembl ID: | ENSMODG00000006652 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:3300] |
Percent Identity: | 52.83 % |
Parental protein coverage: | 64.56 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | DDLDFETG-DAGASATFPMQ-CSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE |
.DL.F..G..AG.S.TF..Q..S.L.KN....LKG.PCKIV...TSK..KH.....HLV...IF..KK.. | |
Retrocopy | NDLNFHIG<SAGVSGTFHTQ<ASTLKKNHCRILKGQPCKIVGVFTSKSIKHDRFIIHLVHVNIFIRKKLK |
Parental | DICPSTHNMDVPNIKRNDFQ-LIGIQDG-YLSLLQD |
D...ST.NM.V.NIKRNDF..LI.I..G..L.LLQD | |
Retrocopy | DTYSSTYNMVVLNIKRNDFH<LIVILNGHFLILLQD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000132507 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000012032 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000012459 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006206 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000006652 | 2 retrocopies |
retro_mdom_1641 , retro_mdom_190,
|
Otolemur garnettii | ENSOGAG00000014230 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007907 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008674 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000016478 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000017939 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009783 | 1 retrocopy |