RetrogeneDB ID: | retro_mdom_2016 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | X:36942655..36943000(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDCD2 | ||
Ensembl ID: | ENSMODG00000007641 | ||
Aliases: | None | ||
Description: | NudC domain containing 2 [Source:HGNC Symbol;Acc:30535] |
Percent Identity: | 83.48 % |
Parental protein coverage: | 60.21 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GTLRGQLGAEGSMSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQEIQCGLQSRHVELAVRG |
GTL..QLGAEGSMSAPF.E....VPCG.PWGQW.Q.LEEVFIEV.VPPGTR.QEIQCGLQSRHVELAV.G | |
Retrocopy | GTLQEQLGAEGSMSAPFVEQNRMVPCGIPWGQWCQSLEEVFIEVWVPPGTRVQEIQCGLQSRHVELAVWG |
Parental | QEILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSL |
QEILKGKLFDST.ADEGTWTLEDRKMV..VLTKTKR..ANCW.SL | |
Retrocopy | QEILKGKLFDSTVADEGTWTLEDRKMVPVVLTKTKRYVANCWASL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 26 .46 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .61 RPM |
SRP007412_heart | 0 .00 RPM | 20 .93 RPM |
SRP007412_kidney | 0 .00 RPM | 19 .75 RPM |
SRP007412_liver | 0 .00 RPM | 30 .71 RPM |
SRP007412_testis | 0 .00 RPM | 25 .14 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005270 | 1 retrocopy | |
Bos taurus | ENSBTAG00000014772 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015367 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000877 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000014291 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004802 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001670 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007641 | 2 retrocopies |
retro_mdom_1058, retro_mdom_2016 ,
|
Ornithorhynchus anatinus | ENSOANG00000021414 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005783 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024929 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007551 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028665 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000307 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000008090 | 1 retrocopy |