RetrogeneDB ID: | retro_mdom_588 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:422741504..422741903(-) | ||
Located in intron of: | ENSMODG00000019794 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000008032 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.09 % |
Parental protein coverage: | 53.78 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 2 |
Parental | CCTASTSIAAHEDASHSYGFNFNHCGTMTPACKRHFVQDTCLYECSPNLGPWIQPVNSSWRKERVMNIPL |
CCT...S.AAHED.SH.Y.F..NH.G.M.P.CK.HF.QDT..YE.S.NLGP..Q.......KE.....P. | |
Retrocopy | CCTVNISLAAHEDTSHLYNFKYNHFGMMSPTCKHHFIQDTRVYE*SSNLGPSFQQKDLCRWKE*MLIMPS |
Parental | CKEDCNMWWEDCKTSYTCKENWQKGWNWSSG-INECPVKAACHPFSFYFPTPTSLC-ENIWSRSYNA |
C.E..N.W.ED....YT..E..Q......SG.IN..P.KA..HPF.FY.PTP.SL..ENIW..SY.A | |
Retrocopy | CRENYNHW*EDYR-YYTSRELAQR-LEFDSG>IN*YPCKAV*HPFTFYSPTPASLV<ENIWNHSYKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
SRP007412_heart | 0 .20 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000005777 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015224 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000856 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000015365 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014126 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000008017 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000008032 | 1 retrocopy |
retro_mdom_588 ,
|
Monodelphis domestica | ENSMODG00000008042 | 1 retrocopy | |
Mus musculus | ENSMUSG00000001827 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000165 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000000641 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000003503 | 3 retrocopies |