RetrogeneDB ID: | retro_mdom_603 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:487906409..487906796(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TAF12 | ||
Ensembl ID: | ENSMODG00000010943 | ||
Aliases: | None | ||
Description: | TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [Source:HGNC Symbol;Acc:11545] |
Percent Identity: | 74.44 % |
Parental protein coverage: | 62.44 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | PHNPKKKQDLDKLHELKAKARQIMNQFGPSALINLSNFSSIKPEPSSTPPQGSMANSTTVGKMPGPPGAG |
PHN.KKKQDL.KLHELKAKA.QIMNQF.PSALINLS..SSIK.EPSST..Q.S.ANSTTVGKMPG.PGAG | |
Retrocopy | PHNLKKKQDLHKLHELKAKAQQIMNQFVPSALINLS--SSIKSEPSST--QRSVANSTTVGKMPGSPGAG |
Parental | GRLSPESNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNT |
G.LSPESNQVLTKKKL..LVRE..PNEQLDE..E.ML...AD.FIE.VVT...QL.....S.T | |
Retrocopy | GHLSPESNQVLTKKKLHHLVREGGPNEQLDEAIEQMLQHFADYFIENVVTTVYQLGSKMSSCT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 1 .67 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .65 RPM | 0 .00 RPM |
SRP007412_heart | 0 .20 RPM | 0 .00 RPM |
SRP007412_kidney | 1 .32 RPM | 0 .00 RPM |
SRP007412_liver | 1 .01 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004366 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000009742 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009044 | 3 retrocopies | |
Dipodomys ordii | ENSDORG00000015036 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000012597 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000000914 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000012595 | 8 retrocopies | |
Monodelphis domestica | ENSMODG00000010943 | 1 retrocopy |
retro_mdom_603 ,
|
Mustela putorius furo | ENSMPUG00000015506 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000003935 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000001524 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000048288 | 1 retrocopy | |
Sorex araneus | ENSSARG00000007568 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000005320 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005548 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000006779 | 1 retrocopy |