RetrogeneDB ID: | retro_mdom_938 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:498253149..498253326(-) | ||
Located in intron of: | ENSMODG00000023201 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000023200 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.77 % |
Parental protein coverage: | 83.54 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSCQQNQQQCQPPPKCQTPKCQTPKCPPKSPQAPCTPPVSSCCCGSSGGCCGCSSG---GCCGSSSGGC |
MSCQQNQQQC..PP....PKCQ.PKCP...PQAPC.PP.SSC...S.GG..GCSSG...GC...S.GGC | |
Retrocopy | MSCQQNQQQCL-PP----PKCQAPKCP---PQAPCSPPISSCSGSSFGG--GCSSGSEIGCSSGSEGGC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Monodelphis domestica | ENSMODG00000023200 | 3 retrocopies |
retro_mdom_713, retro_mdom_937, retro_mdom_938 ,
|