RetrogeneDB ID: | retro_mdom_940 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:516764956..516765114(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000007240 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.91 % |
Parental protein coverage: | 78.26 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | CHSLRTTKSDFYIWSRFKFLPCLFFFFFLKQFS-KVLKGKSEFLWILLVPALRFF |
C.SLRTTKSDFYIWS......C.......KQFS.KVLKGKSEFLWILLVPA.RFF | |
Retrocopy | CQSLRTTKSDFYIWSQ-NLGSCPVXXXXXKQFS<KVLKGKSEFLWILLVPAFRFF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Monodelphis domestica | ENSMODG00000007240 | 2 retrocopies |
retro_mdom_421, retro_mdom_940 ,
|