RetrogeneDB ID: | retro_meug_1671 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold52243:12199..12427(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COA3 | ||
| Ensembl ID: | ENSMEUG00000011666 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly factor 3 [Source:HGNC Symbol;Acc:24990] |
Retrocopy-Parental alignment summary:
>retro_meug_1671
CGGCGCATTGATCCTGCGCGAGAGAAACTGAGCCCGGCCCAGCTGCGCTTCATGCGGCAGGTAGAGCTCTCCCAGTGGCA
GAAAACGCTTCTGCAGCAGCGGGGCCGGAACATGGTGACTGGCCTGAGCATCGGGGCCTTGGTGTTGGCCATTTATGGGT
ATACATTCTACTCAGTGTCGCAGGAGCGGTTCCTAGATGATTTGGAAGACAAGGCCAAAGCTGCTAGA
ORF - retro_meug_1671 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 77.63 % |
| Parental protein coverage: | 76.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | QRIDPAREKLSPAQLHFMRQVELSQWQKTLPQRRGRNIVTGLSIGALVLAIXXXXXXXXXXXXFLDDLED |
| .RIDPAREKLSPAQL.FMRQVELSQWQKTL.Q.RGRN.VTGLSIGALVLAI............FLDDLED | |
| Retrocopy | RRIDPAREKLSPAQLRFMRQVELSQWQKTLLQQRGRNMVTGLSIGALVLAIYGYTFYSVSQERFLDDLED |
| Parental | KAKAAR |
| KAKAAR | |
| Retrocopy | KAKAAR |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Macropus eugenii was not studied using RNA-Seq expression data.
Macropus eugenii was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_meug_1671 retrocopy.
Macropus eugenii was not studied using FANTOM5 data.
retro_meug_1671 was not experimentally validated.
Retrocopy orthology:
Macropus eugenii does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000011666 | 2 retrocopies |
retro_meug_1671 , retro_meug_454,
|