RetrogeneDB ID: | retro_meug_587 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold142359:3285..3449(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000015637 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.29 % |
| Parental protein coverage: | 54.46 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | TGFIQWLRNSASGHNLQAKLQLRYQEIAKRTQPPPKLPVGPSHKF-SNNYYCTRDG |
| ..F.QWL.N.....N.QA.LQ..YQ.IAKR.Q.PPKLPVGP.HKF..NNYY.TRDG | |
| Retrocopy | SSFMQWLWNLTPRCNCQANLQFYYQVIAKRIQLPPKLPVGPRHKF<LNNYYYTRDG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000685 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010709 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000012324 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000015637 | 3 retrocopies |
retro_meug_1487, retro_meug_149, retro_meug_587 ,
|
| Rattus norvegicus | ENSRNOG00000006939 | 2 retrocopies |