RetrogeneDB ID: | retro_meug_838 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold20389:15828..16053(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMEUG00000014652 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPP14 | ||
Ensembl ID: | ENSMEUG00000010883 | ||
Aliases: | None | ||
Description: | ribonuclease P/MRP 14kDa subunit [Source:HGNC Symbol;Acc:30327] |
Percent Identity: | 86.67 % |
Parental protein coverage: | 60.48 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PSEYHYMKVQLEFQDRGFRLTDAQFKQLIVLALKDLFGEVGAALPFDVLTYEEKTLSAILRICSRGLVKV |
PSEYHYMKVQ.EFQ..GFRLTDAQFK.LI.LALKDLFGE.GA.LPFDVLT.EEKTLSAILRICS.GLVKV | |
Retrocopy | PSEYHYMKVQFEFQNHGFRLTDAQFK*LIILALKDLFGEAGAVLPFDVLTCEEKTLSAILRICSSGLVKV |
Parental | WSSLT |
W.SLT | |
Retrocopy | WNSLT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000019987 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000004281 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013439 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000010883 | 1 retrocopy |
retro_meug_838 ,
|
Microcebus murinus | ENSMICG00000014541 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007998 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000022513 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027202 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000039829 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000015394 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013343 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000000935 | 1 retrocopy |