RetrogeneDB ID: | retro_mluc_602 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429769:17783130..17783313(+) | ||
| Located in intron of: | ENSMLUG00000009240 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPP1R14B | ||
| Ensembl ID: | ENSMLUG00000022952 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.61 % |
| Parental protein coverage: | 84.72 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EEEIPELEIDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK |
| .E.I..LEIDVDELLDMESDDT.A.RVKELL.DCYKPTEAFISGLLDK..GMQKLST.QKK | |
| Retrocopy | QEDILGLEIDVDELLDMESDDTQASRVKELLFDCYKPTEAFISGLLDKTGGMQKLSTYQKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Myotis lucifugus | ENSMLUG00000022952 | 3 retrocopies |
retro_mluc_466, retro_mluc_602 , retro_mluc_742,
|
| Myotis lucifugus | ENSMLUG00000023245 | 2 retrocopies |