RetrogeneDB ID: | retro_mmul_1034 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 13:79538553..79538796(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.3091 | ||
| Ensembl ID: | ENSMMUG00000000991 | ||
| Aliases: | None | ||
| Description: | regenerating islet-derived 1 alpha precursor [Source:RefSeq peptide;Acc:NP_001253449] |
Retrocopy-Parental alignment summary:
>retro_mmul_1034
TTGTTTCTTTTCCCAGGACAGGAGGGCCAGGCTGAGTTGCCCAAGGCCCGTATCAGCTGCCCAGAAGGCACCAATGCCTG
TGGCTCCTACTGCTACTACTTTAATGAAGACCTTGAGATCTGGGTTGATGCAGATGTGAGTGAGGAGAGCAGTGTGGGAA
GGGAGGCTCATGAAGGGAGGGGAAGCTGCCACTCTCCAGTGTGTTCAGTGGCTGATATGAGATGAGACTTGTCCCCTCCC
TAT
ORF - retro_mmul_1034 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 59.26 % |
| Parental protein coverage: | 61.83 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | LSLSQGQEVQTDLPKARISCPEGTNAYGSYCYYFNEDLETWVDADVSEVVGENRRWHWSSGSLVSYKSWV |
| L.L..GQE.Q..LPKARISCPEGTNA.GSYCYYFNEDLE.WVDADVSE.....R..H...GS..S....V | |
| Retrocopy | LFLFPGQEGQAELPKARISCPEGTNACGSYCYYFNEDLEIWVDADVSEESSVGREAHEGRGSCHSPVCSV |
| Parental | IGSPSSINPGY |
| ........P.Y | |
| Retrocopy | ADMR*DLSPPY |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .11 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .16 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .08 RPM |
Macaca mulatta was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmul_1034 retrocopy.
Macaca mulatta was not studied using FANTOM5 data.
retro_mmul_1034 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmul_1034 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macaca mulatta | ENSMMUG00000000991 | 1 retrocopy |
retro_mmul_1034 ,
|
| Otolemur garnettii | ENSOGAG00000005808 | 1 retrocopy |