RetrogeneDB ID: | retro_mmul_735 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214768705:2..355(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.13849 | ||
| Ensembl ID: | ENSMMUG00000016512 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:F7G0S7] |
| Percent Identity: | 92.44 % |
| Parental protein coverage: | 52.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWD |
| GPPKYTKSVLKKGDKTNFPK.GDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKV.VGKV.RGW. | |
| Retrocopy | GPPKYTKSVLKKGDKTNFPKRGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVRVGKVVRGWG |
| Parental | EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFE-VELVDID |
| EALLTMSK.EKA.LEIEPEWAYGKKGQPDAKIPPNAK.IF..VELVDID | |
| Retrocopy | EALLTMSKVEKAGLEIEPEWAYGKKGQPDAKIPPNAKPIFK<VELVDID |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 33 .95 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 22 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 30 .61 RPM |
| SRP007412_heart | 0 .00 RPM | 42 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .49 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .23 RPM |
| SRP007412_testis | 0 .04 RPM | 20 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014018 | 4 retrocopies | |
| Felis catus | ENSFCAG00000027304 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003572 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004962 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007405 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016512 | 2 retrocopies |
retro_mmul_2094, retro_mmul_735 ,
|
| Monodelphis domestica | ENSMODG00000007352 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020949 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003012 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004629 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006017 | 13 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006664 | 1 retrocopy |