RetrogeneDB ID: | retro_mmus_1795 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 18:80188767..80189070(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Eny2 | ||
| Ensembl ID: | ENSMUSG00000022338 | ||
| Aliases: | Eny2, 1810057B09Rik, 6720481I12, DC6, Ey2 | ||
| Description: | enhancer of yellow 2 homolog (Drosophila) [Source:MGI Symbol;Acc:MGI:1919286] |
| Percent Identity: | 75.25 % |
| Parental protein coverage: | 99.01 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE |
| MVVSKMNKDA.MRA..NQKLIE.GERERLKELLRA.L.EC.WKDQLKAH.KEVIKEKGL...T.DD.VAE | |
| Retrocopy | MVVSKMNKDAEMRAMVNQKLIEAGERERLKELLRAELTECSWKDQLKAHSKEVIKEKGLGYITIDDMVAE |
| Parental | ITPKGRALVPDSVKKE-LLQRIRTFLAQHAS |
| .TPKGR......V.K..LLQR.RTFL.QHAS | |
| Retrocopy | LTPKGREPWYLTV*KKELLQRMRTFLVQHAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 38 .99 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 26 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 43 .06 RPM |
| SRP007412_liver | 0 .00 RPM | 34 .65 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .84 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000007387 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010882 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000005873 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000022338 | 3 retrocopies |
retro_mmus_1055, retro_mmus_1795 , retro_mmus_3511,
|
| Rattus norvegicus | ENSRNOG00000004681 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005590 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |