RetrogeneDB ID: | retro_mmus_790 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 11:52116491..52116743(-) | ||
Located in intron of: | ENSMUSG00000097219 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lyrm2 | ||
Ensembl ID: | ENSMUSG00000045854 | ||
Aliases: | None | ||
Description: | LYR motif containing 2 [Source:MGI Symbol;Acc:MGI:1917573] |
Percent Identity: | 93.02 % |
Parental protein coverage: | 97.73 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | AASRLPPAALTLKQFMRRQQVLLLYRKILRAIRQVPSDSDRKYLQDWAREEFKRNKSATEEDTIRMMITQ |
AASRLPPAALTLKQFMRRQQVLLLYRKILRAIRQVPSDSD.KYL.DWAR.EFKRNKSA.EEDT..MMITQ | |
Retrocopy | AASRLPPAALTLKQFMRRQQVLLLYRKILRAIRQVPSDSD*KYL*DWARKEFKRNKSAIEEDT--MMITQ |
Parental | GNMQLKELERTLALAN |
GNMQLKELERTLALAN | |
Retrocopy | GNMQLKELERTLALAN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .05 RPM | 8 .32 RPM |
SRP007412_cerebellum | 0 .09 RPM | 5 .78 RPM |
SRP007412_heart | 0 .00 RPM | 15 .07 RPM |
SRP007412_kidney | 0 .06 RPM | 18 .27 RPM |
SRP007412_liver | 0 .08 RPM | 7 .13 RPM |
SRP007412_testis | 0 .00 RPM | 11 .94 RPM |
ENCODE library ID | Target | ChIP-Seq Peak coordinates |
---|---|---|
ENCFF001YKA | POLR2A | 11:52117260..52118181 |
Experiment type: | PCR amplification |
---|---|
Forward primer: | GAAGTAGCCCTTCAGTACTTTG (22 nt long) |
Reverse primer: | CTTCATTTACATTCTTGATTAGAGTG (26 nt long) |
Anneling temperature: | 53 °C |
(Expected) product size: | 417 |
Electrophoresis gel image: | |
Additional comment: | Pfu DNA Polymerase; pooled mouse cDNA; 40 cycles of PCR |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Macropus eugenii | ENSMEUG00000009916 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012230 | 2 retrocopies | |
Mus musculus | ENSMUSG00000045854 | 2 retrocopies |
retro_mmus_474, retro_mmus_790 ,
|
Otolemur garnettii | ENSOGAG00000034900 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000004324 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000016198 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007420 | 1 retrocopy |