RetrogeneDB ID: | retro_ocun_1111 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 2:106460289..106460528(-) | ||
| Located in intron of: | ENSOCUG00000005236 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AS3MT | ||
| Ensembl ID: | ENSOCUG00000000626 | ||
| Aliases: | None | ||
| Description: | arsenic (+3 oxidation state) methyltransferase [Source:HGNC Symbol;Acc:17452] |
Retrocopy-Parental alignment summary:
>retro_ocun_1111
ACCTGTGGTAACAGTGCGTTCCTGCTCACCAAGCAGGTGCTGAAGGCCTGCCAGAGCCCGGAGCTGCAAGGTCGGGCAGC
TCAAGATGTGGCACTGCGGGGAGAAGCCATCTTGCACCCAGGAGGTAGTTTAGAGAAAATGACAATGATAAATACTCATT
TCAATACCAGCCAGAAGCTGTTCAGAACAATGTTGAGCAGTTGTCAGATCCATAGGACCAGTTGAGTCATCTGTTGAAA
ORF - retro_ocun_1111 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 58.02 % |
| Parental protein coverage: | 75.47 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | TCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTH-LQYQQEAIQKNVEQSS |
| TCG.....LTKQVLK...S.EL.G.AA....L...AILH...SL.KM..I.TH..QYQ.EA.Q.NVEQ.S | |
| Retrocopy | TCGNSAFLLTKQVLKACQSPELQGRAAQDVALRGEAILHPGGSLEKMTMINTH<FQYQPEAVQNNVEQLS |
| Parental | DLQDQLNHLLK |
| D..DQL.HLLK | |
| Retrocopy | DP*DQLSHLLK |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .82 RPM |
| SRP017611_kidney | 0 .00 RPM | 25 .74 RPM |
| SRP017611_liver | 0 .00 RPM | 19 .96 RPM |
Oryctolagus cuniculus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ocun_1111 retrocopy.
Oryctolagus cuniculus was not studied using FANTOM5 data.
retro_ocun_1111 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ocun_1111 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryctolagus cuniculus | ENSOCUG00000000626 | 1 retrocopy |
retro_ocun_1111 ,
|
| Procavia capensis | ENSPCAG00000000867 | 1 retrocopy |