RetrogeneDB ID: | retro_ocun_985 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 18:7657783..7657972(-) | ||
| Located in intron of: | ENSOCUG00000012865 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RBP2 | ||
| Ensembl ID: | ENSOCUG00000008146 | ||
| Aliases: | None | ||
| Description: | retinol binding protein 2, cellular [Source:HGNC Symbol;Acc:9920] |
| Percent Identity: | 53.97 % |
| Parental protein coverage: | 50.82 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | EYTKGLDNRHVKTLVTWEGDCLVCVQKGEKEN-RGWRQWIEDGKLHLELTCGDQVCHQVFKKK |
| E...GLD....K.LV.W.GD.L.....G..E.....RQWI...KLHLELT.G.QVCHQVF.KK | |
| Retrocopy | ECAEGLDS*CGKMLVSWGGDVLCAYTGGGREECPS*RQWIKGDKLHLELT*GNQVCHQVFTKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008146 | 1 retrocopy |
retro_ocun_985 ,
|