RetrogeneDB ID: | retro_ogar_1800 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873566.1:9652007..9652242(+) | ||
| Located in intron of: | ENSOGAG00000016051 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM243 | ||
| Ensembl ID: | ENSOGAG00000000023 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 243, mitochondrial [Source:HGNC Symbol;Acc:21707] |
| Percent Identity: | 83.54 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MEDFSTRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQVPPKPLNIFF-AVCIS |
| ME.FS.RTY..SGLDNRPLFGE..AKDR.INLVVGSLTSLLILVTLISA.VF.QVPPKPLN.FF.AV.IS | |
| Retrocopy | MENFSIRTYSPSGLDNRPLFGEMLAKDRLINLVVGSLTSLLILVTLISALVFFQVPPKPLNVFF>AVYIS |
| Parental | LSSITACIL |
| LSSITA.IL | |
| Retrocopy | LSSITAFIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004888 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000014707 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000023 | 2 retrocopies |
retro_ogar_1800 , retro_ogar_383,
|
| Rattus norvegicus | ENSRNOG00000042758 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000002439 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007846 | 3 retrocopies |