RetrogeneDB ID: | retro_ogar_2801 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873665.1:140426..140664(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | APOC1 | ||
| Ensembl ID: | ENSOGAG00000028159 | ||
| Aliases: | None | ||
| Description: | apolipoprotein C-I [Source:HGNC Symbol;Acc:607] |
| Percent Identity: | 65.85 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MRLMLSLPVLVLV-LAMVLEGPAPAQGTMDLDFTRH-LKEFG-NTMGDKAREVIDRIKQSDIPAKTRNWF |
| .RLMLSL..LV.V.L.M.LEGPAPAQ...D...T...LKEF..N.M.DKA.EVID..KQS.I..KTRNWF | |
| Retrocopy | VRLMLSLLILVWV<LSMDLEGPAPAQAAPDFSGTLNKLKEFE<NAMEDKA*EVIDCMKQSNISTKTRNWF |
| Parental | SETFQKVKEKLK |
| SE.F.KVKEKLK | |
| Retrocopy | SEAFEKVKEKLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012737 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004615 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028159 | 1 retrocopy |
retro_ogar_2801 ,
|
| Rattus norvegicus | ENSRNOG00000018426 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007093 | 2 retrocopies |