RetrogeneDB ID: | retro_ogar_3275 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873763.1:408740..408923(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CSTB | ||
Ensembl ID: | ENSOGAG00000006101 | ||
Aliases: | None | ||
Description: | cystatin B (stefin B) [Source:HGNC Symbol;Acc:2482] |
Percent Identity: | 58.73 % |
Parental protein coverage: | 64.29 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | PATAKTQDIADQVKSQLEEKENKKFPVFKAVSFKSQVVAGTNFFIKVHVGDEKFVHLRVFQSL |
P.......I..Q.KS.LE.KE.KKF.VFKA.SFKSQVVAG.N.FIKVH.GD....HL....SL | |
Retrocopy | PSPCRPHGITNQAKSKLELKE-KKFSVFKANSFKSQVVAGIN-FIKVHAGDQNIIHLHFGVSL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000000524 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002664 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000022457 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012303 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006101 | 2 retrocopies |
retro_ogar_3274, retro_ogar_3275 ,
|
Pteropus vampyrus | ENSPVAG00000007022 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000001201 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017952 | 3 retrocopies |