RetrogeneDB ID: | retro_opri_1160 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_820:139036..139261(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GMFG | ||
| Ensembl ID: | ENSOPRG00000015157 | ||
| Aliases: | None | ||
| Description: | glia maturation factor, gamma [Source:HGNC Symbol;Acc:4374] |
| Percent Identity: | 75.32 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | FVVYSYKYLHADGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNR-LVQTAELTKVFEI-RTTEDLTEAWLR |
| F.VYSYKY.H.DG..S.PLCFIFS.PV..KPEQQMMYAGSKN..LVQTAELTK.FEI..TTEDLTE..L. | |
| Retrocopy | FIVYSYKYQHDDGKISHPLCFIFSCPVE*KPEQQMMYAGSKNK>LVQTAELTKMFEI<KTTEDLTEE*LH |
| Parental | EKLAFFR |
| E.L.FFR | |
| Retrocopy | ENLGFFR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000006529 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000008573 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006957 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000060791 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015157 | 2 retrocopies |
retro_opri_1160 , retro_opri_160,
|
| Sarcophilus harrisii | ENSSHAG00000008772 | 1 retrocopy |