RetrogeneDB ID: | retro_pabe_1880 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 22:26244892..26245075(+) | ||
Located in intron of: | ENSPPYG00000011730 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPP1R14C | ||
Ensembl ID: | ENSPPYG00000017102 | ||
Aliases: | None | ||
Description: | protein phosphatase 1, regulatory (inhibitor) subunit 14C [Source:HGNC Symbol;Acc:14952] |
Percent Identity: | 62.3 % |
Parental protein coverage: | 67.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPTEEFIKELLSRIRGMRKLSPPQKK |
EEE..E.EID.D.LLD..SD..RA....E.L.DCYKPTE.FI..LL..IR.M.KLS.PQKK | |
Retrocopy | EEEISELEIDVDELLDMESDDARAASVKELLIDCYKPTEAFISGLLDKIRAMQKLSTPQKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 1 .44 RPM | 1 .11 RPM |
SRP007412_cerebellum | 0 .85 RPM | 1 .22 RPM |
SRP007412_heart | 0 .96 RPM | 4 .30 RPM |
SRP007412_kidney | 2 .85 RPM | 1 .56 RPM |
SRP007412_liver | 3 .18 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000026586 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017261 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000023245 | 2 retrocopies | |
Mus musculus | ENSMUSG00000040653 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000017102 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000002873 | 1 retrocopy |