RetrogeneDB ID: | retro_pabe_2084 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2b:113486726..113486921(+) | ||
Located in intron of: | ENSPPYG00000013217 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000007915 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 64.62 % |
Parental protein coverage: | 57.52 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGEELFDKANKHHFLHSLALLGVPHCRKPL |
.AGP.AAF..LG.LS.A.ALG..S.G.H..QF.DAY..ELFD.AN.HHF.HSLALL...HCR.PL | |
Retrocopy | LAGPGAAFCHLGTLSVAGALGLTS*GVHTTQFLDAYWKELFDTANAHHFSHSLALLRGLHCRRPL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .76 RPM |
SRP007412_cerebellum | 0 .00 RPM | 2 .31 RPM |
SRP007412_heart | 0 .00 RPM | 4 .91 RPM |
SRP007412_kidney | 0 .00 RPM | 14 .02 RPM |
SRP007412_liver | 0 .00 RPM | 16 .43 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2212 |
Pan troglodytes | retro_ptro_1678 |
Gorilla gorilla | retro_ggor_1745 |
Macaca mulatta | retro_mmul_929 |