RetrogeneDB ID: | retro_pabe_2101 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2b:12900434..12900788(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000003223 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.67 % |
Parental protein coverage: | 99.15 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MKTVLGFKGLFYLHSLIWTCAGDWSAIQVHCTQFWFFARIKPTIFYNLYVNPDEVF-LGDGCCVTHVLPN |
.KT.LG..GLF..H..I.TC.GDWSA.Q..CTQFWF.ARI.PT.F.N.Y.NP..V...GD.C..T.VL.N | |
Retrocopy | IKTFLGLRGLFLVHYFIRTCTGDWSAVQLQCTQFWFCARIRPTVFQNSYTNPNKVL<KGDDCPITYVLLN |
Parental | VY-YEFFYHPHDCGIVTQPLQE-VLLLKTKIKHISRDSTVRSEMPLSCVV |
VY......HP..CGIVT..LQE...LLKTKIK.ISR.STV.SEMPL.CVV | |
Retrocopy | VYLXXXXXHPQECGIVTETLQE>IPLLKTKIKCISRNSTVPSEMPLLCVV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .17 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1709 |
Pan troglodytes | retro_ptro_1635 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000027348 | 1 retrocopy | |
Homo sapiens | ENSG00000214788 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016792 | 6 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013194 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000003223 | 20 retrocopies |
retro_pabe_1419, retro_pabe_1525, retro_pabe_1707, retro_pabe_1713, retro_pabe_1716, retro_pabe_1720, retro_pabe_1745, retro_pabe_1749, retro_pabe_1761, retro_pabe_2101 , retro_pabe_3226, retro_pabe_3227, retro_pabe_3229, retro_pabe_331, retro_pabe_3530, retro_pabe_3539, retro_pabe_3546, retro_pabe_3561, retro_pabe_3580, retro_pabe_3585,
|
Pan troglodytes | ENSPTRG00000034506 | 18 retrocopies |
retro_ptro_1635, retro_ptro_2588, retro_ptro_2591, retro_ptro_2593, retro_ptro_292, retro_ptro_3066, retro_ptro_3081, retro_ptro_3082, retro_ptro_3084, retro_ptro_3085, retro_ptro_3087, retro_ptro_3088, retro_ptro_3284, retro_ptro_3289, retro_ptro_3293, retro_ptro_3300, retro_ptro_3305, retro_ptro_3309,
|