RetrogeneDB ID: | retro_pabe_2561 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 4:129166851..129167290(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TECR | ||
| Ensembl ID: | ENSPPYG00000009648 | ||
| Aliases: | None | ||
| Description: | trans-2,3-enoyl-CoA reductase [Source:HGNC Symbol;Acc:4551] |
| Percent Identity: | 79.33 % |
| Parental protein coverage: | 56.49 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MKHYEVEILDAKTREKLCFLDKVEPHATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLKDEDVLQKLPV |
| MKH.EVEILDAKTREKLCFLDK.EPH.T..EIKNLFTKT...WYPA.Q.L.LDPKGKSLKDEDVLQKLP. | |
| Retrocopy | MKH*EVEILDAKTREKLCFLDKGEPHTTNVEIKNLFTKTPL*WYPAQQCLHLDPKGKSLKDEDVLQKLPG |
| Parental | -GTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFR-VPFIYGHKYDFTSSRHTVVHLACICHSFHY |
| .G.TATLYF..LGA.ISWVTVFLTEY.G.LFIY.L.....VPFIYGHKYDFTSSR..VVH.ACICHSFH. | |
| Retrocopy | <GATATLYFQGLGAKISWVTVFLTEYGGRLFIY-LLFYE<VPFIYGHKYDFTSSRDSVVHIACICHSFHN |
| Parental | VKRLLETLFV |
| VK.LLETLF. | |
| Retrocopy | VKHLLETLFM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 56 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 51 .44 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 41 .93 RPM |
| SRP007412_liver | 0 .00 RPM | 27 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000020013 | 1 retrocopy | |
| Homo sapiens | ENSG00000099797 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031708 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013546 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009648 | 2 retrocopies |
retro_pabe_2561 , retro_pabe_3591,
|
| Rattus norvegicus | ENSRNOG00000021808 | 1 retrocopy |